PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11462.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 257aa    MW: 28718 Da    PI: 4.8341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11462.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTteEd++l+ +++ +G g+W++ +++ g+ R++k+c++rw +yl
  mrna11462.1-v1.0-hybrid 14 KGPWTTEEDQILISYIQTYGHGNWRALPKHAGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding50.54.9e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  mrna11462.1-v1.0-hybrid  67 RGNFSREEEDAIINLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.251961IPR017930Myb domain
SuperFamilySSF466894.67E-3110108IPR009057Homeodomain-like
SMARTSM007174.4E-151363IPR001005SANT/Myb domain
PfamPF002497.3E-171461IPR001005SANT/Myb domain
CDDcd001672.50E-121661No hitNo description
PROSITE profilePS5129425.08562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665117IPR009057Homeodomain-like
SMARTSM007171.5E-1466114IPR001005SANT/Myb domain
PfamPF002497.2E-1567112IPR001005SANT/Myb domain
CDDcd001675.53E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTTE EDQILISYIQ TYGHGNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SREEEDAIIN LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLIKRD  120
NTTSPTCSTS NLTGQYAEPE CVNFESTTSH ASMSPQPSSS EDVSSVTEAS AATGQNMIKD  180
EKIELDATFS DFDDSFWSEA LSADNSGDIP LEFLEGTNDQ AQPELPFPSN IGDGMEFWYD  240
LFIKAGHGGT PELPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296369.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH43e-78MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM5XC631e-120M5XC63_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s24550.14e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-83myb domain protein 14